PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003874.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 465aa    MW: 53098.6 Da    PI: 8.5869
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003874.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS384.41.3e-117894591373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l+ lL+ cA+avs++d + a++lL+++++++sp gd  qRla++f+ AL+arla+++++ly al++++t     ++ l+a++++ +++P++k   ++a
  Pbr003874.1  89 LRALLILCAQAVSADDRRTANELLKQIRQHSSPFGDGSQRLAHCFAYALEARLAGTGTQLYTALSSKRTL---DADMLKAYQTYIKACPFMKAVIVIA 183
                  5789***********************************************************9999987...899********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N++I + +e++e++HiiDf+i +G+QWpaL++ L+ Rp+gpp+lRiTg++ p+sg   +e+++etg+rLak++e+ +vpfe+n  ++k++e++++eeL
  Pbr003874.1 184 NHTISKLAEKAETLHIIDFGILYGFQWPALIHCLSRRPGGPPKLRITGIELPRSGfrPEERVQETGHRLAKYCERYNVPFEYNG-IVKKWETIQYEEL 280
                  ******************************************************9*****************************.7************ PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +vk++E+laVn  ++ ++llde+v+++s+rd+vL+l+++++P++++++  + ++n++ F++rf eal ++sa+fd+ +++lpre+ +r + E+e+lgr
  Pbr003874.1 281 KVKRDEVLAVNNLFRFYNLLDETVTVNSPRDAVLNLIRGMNPEIFILSIINGSYNAPFFVTRFREALLHFSAFFDMCDTNLPREDPTRLMFEEEFLGR 378
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  eivn vaceg+er+ r et+++W+ r ++aGFk++pl+ + +++ ++ ++  + + + v+e+ +++++gWk+r ++s S+W
  Pbr003874.1 379 EIVNTVACEGSERVVRPETYKQWQVRNTRAGFKQLPLDRELMNKLRSKVKLGYHRDFVVDEDGNWMLQGWKGRIIYSSSCW 459
                  *****************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.94663440IPR005202Transcription factor GRAS
PfamPF035144.6E-11589459IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MDHPTFNGVP DYMNGFSIGD LAFSPNSTQF PNLINEYQFN QLSPDPNFMG SFCQNEANKA  60
LQQNEQSVGT SNGKTRAKKN GDKKEVVDLR ALLILCAQAV SADDRRTANE LLKQIRQHSS  120
PFGDGSQRLA HCFAYALEAR LAGTGTQLYT ALSSKRTLDA DMLKAYQTYI KACPFMKAVI  180
VIANHTISKL AEKAETLHII DFGILYGFQW PALIHCLSRR PGGPPKLRIT GIELPRSGFR  240
PEERVQETGH RLAKYCERYN VPFEYNGIVK KWETIQYEEL KVKRDEVLAV NNLFRFYNLL  300
DETVTVNSPR DAVLNLIRGM NPEIFILSII NGSYNAPFFV TRFREALLHF SAFFDMCDTN  360
LPREDPTRLM FEEEFLGREI VNTVACEGSE RVVRPETYKQ WQVRNTRAGF KQLPLDRELM  420
NKLRSKVKLG YHRDFVVDED GNWMLQGWKG RIIYSSSCWV PSRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-46934598374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364419.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WJU60.0M5WJU6_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14